Cryoto.Ai Auto Blog Engine

If You Held Crypto on CoinGather in 2017 the US Government Wants to Give it BackIf You Held Crypto on CoinGather in 2017 the US Government Wants to Give it BackCategory: blockchain
Sun May 03 2020 03:00:00 GMT+0000 (Coordinated Universal Time)

The FBI is seeking individuals who held crypto assets on CoinGather who appeared to conduct an exit scam in November 2017.

COVID-19 Domain Seized After Attempted Sale for BTCCOVID-19 Domain Seized After Attempted Sale for BTCCategory: blockchain
Sun Apr 26 2020 06:00:00 GMT+0000 (Coordinated Universal Time)

The fraudulent domain was seized after its owner attempted to sell it to a Homeland Security Department agent

2009blockchain working groupbank of englandblockchain paymentstrump-2020summaarrington xrp capitaltacprysmaticripple ipomillennialsexpansionbitcoin transaction batchingmetamaskxvgnational blockchain roadmapcbp2020 outlookaffiliatedefi pulseсryptocurrenciesorder bookmarket capitalizationauditventuresorarenew yorkpaxjoe bidencoinfirmliquidationfactomhennadii stepanovadult entertainmenttransaction volumemarket makerscentral party schooluk central bankbaosteelian sigalowlebanonberniegood cycleoppositionpete buttigieg petedeutsche bankandrew levinedforce attackbitcoin atmsbull runlicenselogisticsreal visionhouse financial services committeekeepiccparitylondonproprietary tradingbitgo trustdeutschekeysphishingsapphiremike bloomberg. bloombergpeople's bank of chinadigital yenhodlsidechainsjapan revised crypto regulationslithuaniastartuprebroadcast logicbusiness modelicosnearcollateralnew york state department of financial servicesform f1batchingbitcoin batchingpaystandsynthetixpricesbitcoin minercharles schwabheloc$pmacosconsensusvbit technologiescorey pricepornhubstorjliechtensteindiscussion paperssimilarweblicensingbtc pricebrad shermanbitwisebaidubrowserscasperlabsdanny ryanexonumborrowvaluationsengemini dollarcourt casessequoiatelecommunicationsjvceatrade settlementmarketingrujan ignatovavirusgamblingdefi protocolsergi delgadobitcoin fraudmax keiseribm food trustprotestsdotsmark scottember fundsim swaprepomalta financial services authoritypresentationheifer internationalcrypto assetsnodebitboxwinklevoss twinsvlad zamfirgaming industrybinance poolmixerjames smithjoseph ottingpublishingddos attacksbitcoin volatilityrenbtcbank of koreaderivative exchangesfinlandveridum labgsr capitalintrinsic valueapplebobby leedeloittebinance futureshigh frequency tradingdvmdeversifibank of thailandwintermutewintermute tradingaxie infinityearth daynon-fungible tokenclosed-end fundgleb naumenkobinance chinabernie sandersbidenimpersonationelizabeth warrenasia-pacificsaudi arabiabundletrumpcexwarrenbank of japankyber networkcoinbase probitcoin perpetual contractmedium of exchangeswissfincenfeelks foundationtechnology advisory committeebtsemobile walletsignature banklicenseseos ecosystemunited arab emiratesbitnomialdropilchessnational blockchain strategydisinflationaryprototypeinlfation decreasingsupply inflationcelocampacceleratordc barboostvcelaine shiblockchain capital1inchcrypto donationsrootstockmike cagneychangeporfiat valuedouble spendprysmpeckshieldbitcoin reservesshasperseed fundingbuidlpoliticsxmrfomoissuancehut 8global warming$ltcbithumb$zrxcoinbase cardequity investmentcitiribbit capitalunion bank agle quoc-hungdigital euronodesinvestigationjerome powelltoken salescongressmanwebmaxine waterssubcommittee on investor protectionencryptionaustralian securities exchangeandroidgrayscale bitcoin investment truststarbucksnetflixafri schodenexonum enterprisetrade execution platformsexchange feesborrowingdigital security custodychfcubagusdwirexq1fidor bankbittrredeemwaves.exchangecurrencybenoît coeurefliktrafficmark cubantestingfashioncrypto valleyunion square venturesunisocksfilmblacklistfuturswapgpuunionpayindiegogoethereum foundationuphold$sidon tapscottcheckout.comramp capitalcentral cyberspace affairs commissionsmulti-clientskewtradingarab bank switzerlandreserve bank of indiakim jong-unequity marketvaccinemarketplacesframework ventureswaveschangpeng zhoupandemickelly loefflerpeter schifzltstokenanalysttelosevent recapcypheriumtaxationcoingatheralfablokbitinstantpatentsyield protocoliminerrbivelocitylocal currencyfolding@homegitcoinelwood asset managementshardingatomic swapsimmutablepeglinuxshutdownalliancecoldcardreg cfinstitutional investor$sqcryptocurrency transferreal estatev2binary optionscoinsharescrypto banksvalue propositionextensionssamuel reedpricelollibrian armstrongzorahorizon blockchain gamesblockdaemonfrank amatotaxingadambtc contractsripple lendingcoindcxliquidity providersinitial exchange offeringbitcoin hash rate$bch $ltcbinance u.s.anthony scaramuccimmmarthur hayesindex venturesitbitkusamasubreddit$linkstock optionscrystal blockchainataribitcoin etfscoinsbny mellonetfsclass actionbanco santanderblockchain bondsemergency pausesocgen forgecannabistravalabruno le mairetrading firmslightningsichuanfutures tradingllt-pr-16blockchain development fundliquidity injectionindian crypto exchangesrenbchrenzecammunitionsmart contract walletmy crypto heroesmaicapitalnon-fungible tokenshester peirceretirementnc-pr-11central bank of franceinterstellarantminerssoccerinvestment dealsmtg ventureslaw enforcementsynchrolifeciphertraceneutrinojpmorgan chaseammofortespoteuropoltokenized assetsfounders bankroubinigas feessamamarket caputility tokenstom emmerus marshals servicebooksproof-of-registrationcoca-colahelixsylo smart walletfxhashkeysolar energysunexscoopempty blockssexhuman rightsuprightwinklevoss capitalfedblockchain datastress testquadrigacxnew york timesgovernment bondsr&dsnow whitecoinfluxconferenceutrustindia crypto banwash tradingtradercapital gain taxesdigital paymentsfederal lawslightning labsoil pricegas limitfuel labsecosystemfloyd mayweathermulti collateral dainick szabocypherpunks1inch.exchangecrypto fraudtaker-makerelectricityorg chartcrude oilcrude oil futuresernst & youngcoingecko candyprotocol rewardsinternational chamber of commercenz policeclimatesynqaakantimatter kingdomcoinfloorcloud miningvenmomonacoretail brokersonelinkoneliferebatessimon leintegrationhdr groupforksmarkus braunzero-knowledge proofreward systemscustomsmiguel viasinvestment productshuman capitallocationhistorylkscoinbuy$avaxplugintheftabramoffenterprisethe exchangesubsidytrademarkschina central bankmcdonald'sexplotsubwaycardskpmgngncorrelationsocial payment appsretailiron orebitcoin fundscryptopaykucoincheapnetwalkerexpensiveuniversity of california$zecautomated market makerprice feedskyberfake goldprice oracleswashington dcmonolithmorris wormborderless technology25x leverageholdethusdfutures contractsspectrocoinfinancial resultswavecrestcounos platformsignetcoinshufflesouth americacrypto tradinghackathoncrypto mass adoptioncounos decentralized exchangewashingtonswiss isinglobe businessemployment2020 presidential electionhollandkanye westimbtcrenrenbitron pauldefipulselira$sxpofididioverviewbinance research explains the rationale behind its comparison of libra and spacex industry disruption.kevin hartaavet.i.sendmoneyaustraliaremittancesnemblockchain kycdolevoice.comsri lanka central bankthe giving blocktata consultancy servicesbrad garlinghouswiredh&m.eth addressestrading feeshowey testkentuckyhuobi tokenchristopher giancarlokonstantin ignatovbox officehivemarkets analysistrading101mcdexbitfinex pulsereviewhardware walletdronesunmanned aircraftspot exchangechina digital currency research institutesensetimepartnershipscoosimone mainisteamsimplexmatt luongothesisbrian quintenzcardcoinsgrantpayvantinsider tradingforkdebt auctionsafe-haveniosskeweth2.0taurus grouptezos foundations&p 500corda enterpriselinkidentificationgramgram tokensducatimarkets newsmuneeb alistackswall streetgenobankneoplaceholderuniversal market accessfundsbaasadvertisementconstant productinitial dex offeringxrp salesmmc venturessciencecornell universitysellteslavpnelectionsstarkwaremt. goxexit scamomisegonew jerseyremittancegaplessporschezecinsuranceripple incentivesbafinminersvisitorsdonationhitbtcbbvaliquitycoinswapsmonetary policypantera capitalidentityinternet of thingsopence financeleosandboxiotabittrex globalembervbitvbit dcuniversitieseducationrand corporationcares actapplicationsfoundationtrillionscryptocurrency scamnouriel roubinisociosufcgabi tradingjapan crypto regulationsbitcoin suisseetherealchromeharry denleyvccrashprice crashprice fallpwcseed rounddigital dollar foundationdj racblockchain electionblockchain votingblock rewardstuart leveycryptogaminggaming tokensmythical gamesqcp capitaltokocryptokonstantin richterrgb coininstitutional demandinstitutionalisationprofitableaccompliceblockvestdan gallagherphase 0sp500illicit activitiesripple loansrankingstsmcbitcoin hashrate futuresbinance mining poolgas pricegweinetwork congestionsergei mavrodiminerben delobma llcscarcitydollar-cost averagingdarknet marketsdtcclitecoin foundationbitcoin hashratebitcoin minersmining machinesblockchain.cominterest accountsredemptionirohaproject bakongtotnes pounds$algofrance central bankneil shensequoia capital chinaava tokentravelbybitguthrieftx.ussbfgasswiftkleimanmoney transfersalexis ohanianlouisianacoinbase venturespboc governoryi gangdavid marcusrenrenvminstitutionuser statisticsderivatives tradingkingdom trustbooksatoshipaygiancarlobank of francesocgencoronaasset managersantminer t19holdingsliquid networkrestaurantssynchrocoinsquare cryptotalaia labscriminal activitypetroeth/btcpricelesscrypto bankcivilgunsnmrnumeraicommissionermarket manipulationbloomberg intelligencemike mcgloneattacksu.s. attorneydigital dollar projectwasabi walletdeafounders bank projectmaltamfsammttencent cloudrecoveryalgorand foundationsaudi arabian monetary authorityprivacy coinblockchain platformsknow your customerauctionupvestbitcoin billionairesmovieswinklevosscentrapaycoca-cola amatilbinance p2pbtsgreycroftsolar cellssolar powersun exchangetranscation feessurveillancegrayscale bitcoin trustkyle davieslukkataxabsoscseed cxhirestrendsphotosresearch reportthe block researchlaunderingracketeeringiainternet archivebillcrypto banenterprise blockchainsupplyjpmorgan bitcoin reportsweekdayweekendsouth korea central bankarweavearbitrageripiotechnology pioneerswefcentra techdj khaledfortune 100binance.ukhigh feesbarrierschallenges$eth $daiinvestingtradersgovernment agenciesico fraudcrypto taxeyey cryptoprepmoney marketsubsidiesyieldalexander vinnikbtc-eomisesiam commercial bankaddressaml rulesuk crypto regulationselectronic trading0xdecentralized exchangesloopringyield farmingcrypto options exchangessparrowarrestcoingeckoshopinhertzbithumb ipoiposrobo lawyersbasket currencytokenyavalancheapacdevelopersterminalamd$ethemarket dataammblockchain solutionlkslksfoundationm&adefi exploithackercrypto cardssirecardreturnsdex aggregatorbhpperpetual swapransomuniversityasxprotocolstoragehorizenblocksetclouddfinityb2c2sbi securitiesnydiglawyerscurvreplace by feederivadexdragonfly capitalsgxteecl baanxcryptopay.meplutustrastraukexwirecard ukacdxandy cheungfiat gatewaysfiat-to-cryptoincore bankbrokeragedata analyticscounoscounos ubeijingelectronic sealsbitcoin mass adoptionbrock pierceelectionus electionsbinance braziltokenized bitcoinfunddong zhaomonthlymonthly researchsummaryashton kutchersigal mandelkersound ventures#usdgrowing demand in usd transfersubershared kycsri lankaantminer s9india cryptotcsadhuobi tokenspublic marketsnyagpppbat pointsstolenbarclaysbrett tejpaularrano capitalbitcoin fundventure smart asia limitedapple appprofitalpha5eduardo gomezpursebinance smart chainibvixeeanydfsmarket makingseries bdefi value lockedasset managementsteven mnuchingalaxy digitalkomodomufgdappreviewanti-money launderingbitcoin regulationscrypto sitescryptocurrency regulationsfda regulationsico for us residentsnon-regulatedllt-pr-31idaxidax exit scammoneygram internationalindonesiapolychainbitcoin.comfootballrewardsrate cutbitcoin price indexethereum price indexcashbitcoin cash coinbasebitcoin cash to usdbitcoin cash valuebitcoin cash walletbuy bitcoin cashontologynon-custodialfilecoinemin gün sirerprediction marketsgamingerc777goldensand capitalclimate changeplustokenmimblewimblezkpwhitepaperpavel durovposmaker feetaker feeblockstreamchilestateless clientcrisismulticoin capitalvechainburnthiefkincalculationpurse.iotravelbvixirelandcrypto transactionsassetsdubaiuaenon-custodial exchangeopen finacesocial networkssecuritizeopen interest$xlmmkrugandaturkey$zenmuir glacierbitcoin regulation by countrycrypto exchange ratesdigital currency regulationsamiti uttarwarpeople’s bank of chinanew_listingsusdinterest rateethereum classiccommunityceoprivate keysripple price indexbrad garlinghousedai foundationfile sharinghttpnigeriatorvietnamkeep network$trxsantanderinnovationbitlicensecrytptocurrenciescryptographyeconomyportugalinflationdapper labsstateless ethereumblack thursdayebang ipoalibabaeconomicseurocaitlin longripple lawsuitdepartment of justicebinance usnetwork securitysocial paymentsbinance chainbitclubmessaging appcme groupsanctionsbancormalaysiaddosfiatfiguredceppboc central bank digital currencymaker foundationshellbanconsumer protection lawsicextzcontent distributionbettinginfuragramscryptojackingross ulbrichtmiddle eastcoincheckdeposit ratealexey akhunovfund_movementjihan wunorwaydcggenesis capitalavantiwyomingmicree ketuan zhaneth 1.xmetal payapplied blockchainipfstelegram open networkmichael novogratzspainghanahodlingcrypto fundsvideo$stxprihyperinflationlenderacceleratorsraoul palfidelitywomenusproof-of-workcovid19abratoken salesilk roadartblockchain adoptionpatentcambodiaagriculturecopyrightcensorshipdecentralizedbitcoin adoptionecosystem mapcash appnovivoicemass adoptionparadigmstock marketsjed mccalebbitcoin cash forktrade financeeu$dogegoldmansoftwarebitcoin mixersopen sourcebittrexripple xpringbrave adswarren buffettchilizhackingscott stornettaus governmentbankschemedave kleimanwe.tradesebaava labstreasuryblockchain gamingcurve financesai$atomoptimistic rollupsociete generaledigital currency groupinstitutional investorsprime brokerweb3omgconsolfreightbitcoin derivatives$dashwilshire phoenixauguroraclematter labsbank frickblockchain trade finance platformspayrollnumberscrypto collectibleswhatsappseries abitcoin cash vs bitcoinuk fcaseba banktokensoftvisa cardsseizurelawsuitscrypto custodyinstitutional traderstornado cashcrypto cyclestokenunlockerc-20syntheticsus dollarcentrifugepaperchainmainnetcomputer virusargentemployee stock optionsbitclaveomg networkblockchain etfwestern unioncoinsquaresu zhuprivacy coinsprivate placementvoyagernew zealandotc deskoffice of the comptroller of the currencycasadecentralized identificationsymbiontvanguardbitcoin etpsbitflytransaction feeswhatsapp paymentskoreasmart contract vulnerabilityvulnerabilityzkrollupnomuraprofitspfofmergerssaftbinance cardwirecard card solutionsarcaledgerxtenderminttrump admintiktokmarty chavezchina digital currencycdpsam bankman-friedbitstampbitcoin optionsderivatives exchangeethercoinbase custodycustodiandigital yuanether futuresfunding roundthe interchange$repacquisitionsbasic attention tokenspaceeuropean unionmoney launderingdomino's pizzagiveawaysassociationsfatf crypto guidelinesreg a+credit cardpeoplenerdwalletbnp paribasbtchardware walletsjobnc-pr-9blockchain phoneblockchain smartphonecrypto smartphonelg#btccrypto insurancemybd tokenutility tokenllt-pr-13etfnftlegislationukraineeosioceloavatzerovotingtransportpaxfullumenssecurity tokenscolombiacosmosokcoinsteemjustin sunhash ratemining poolpoolinsilvergatenasdaqczfireblocksdigital assetequitycybersecuritysupreme courtcourtsexchange tokencentreerisxsouth africacaliforniaattackerderivative exchangegas feebitcoin coreotctestnetmonthly summarypyramid schemeplatformsmartphonemolochdaosatoshilabsllt-pr-15crypto phonebinance stablecoinitalyxpringprotocol labscanadacoinlistmark zuckerbergzero-knowledge proofstagomitransaction feeapple watching cryptocurrenciesmybdairymexicooverstocksettlementunlockedminer revenuetrade bitcoincrypto hedge fundsa16zamld5contestdogepolandmarket makeranalyst callweb3 foundationieo platformupbithdrmarket structuremolochloanscancordadairydifficultychina cbdcstripecrowdfundingworld economic forumomnidata breachpundi xaccenturecomplianceethermineinsolvencyblockchain analyticspolicy & regulationsthree arrows capitalwbtcoccmicree zhanmoney 2.0 stuffkycreportcrosstowertim drapererc20governance tokenmicrobt$canmergers and acquisitionsgrantsprime brokeragestaking as a servicesparkpoolbalancer labsswipeinstitutionswhatsminer$bchfbiyuandashfatffundraisingpaypalsbibrave browserbuy tron cointron blockchaintron cointron coin pricetron currencytron digital currencytron pricetron todaytron updatestronixtrx price movementwhat is troncrypto regulationspanterau.s. treasurytrezorscalingcse:ncpaxosroger vereuropean central bankbankinginterviewstellar development foundationbusdbitcoin cash newstokenizationonecoindappsdarknetlatin americascalabilityebangstellar lumenspublic companiesrevenuegooglecharlie shremsatoshimining difficultyvolumedark webgbtcdonald trumpbrian brooksbitfuryterrorism$xtztron cryptotron platformmargin tradingnetcents technology inc-prartificial intelligencepolychain capitalbondshusdisraelponzipowbitcoin exchangesaimining poolsandreas antonopoulosmergers & acquisitionstrx pricetron coin newstoken offeringadam backfoodhackersfcauncategorizednetcents technology inc.scamcbdcstron trxpboc digital coinmarketcapargentinacryptokittiesstopolicy & regulationjack dorseykikcrypto miningliquidity mininghdr global tradingdforcehackperpetual swapscrypto exchangeshyperledgermanipulationamazonponzi schemeproof-of-stakeirs$eosvenezuelaetananorth koreaellipticalgorandmalwaredigital assetsandreessen horowitzzcashsenatehashrategoldman sachstradepboctencentdogecoinregulationsdebit cardsstartupsbitflyerfacebook cryptodharmairanhealththailandcharles hoskinsonelon muskoraclesmainstreamsecurity breachf2pooltbtcumajohn mcafeejpmorganibmfederal reservesportfuture of moneybalancersteemitanalysisloanstenxantminerlmax digitalhedge$baldecentralized financebismusicventure capitalliquidityasicbravebrazilcourtinternetpaidprsecurity tokensecuritiescrypto lendinglinewhat is a blockchainlocalbitcoinsusdtfiat moneymacrovirtual blockchain weekblock.onewalletslmaxchainalysislayoffsmicrosoft$dotdefi lendingdigital dollarblockstackcanaanderibit$batanonymitypizzacrypto derivativesgermanycrypto debit cardslibra association$bnbvolatilitysquarebitpaygrayscalefinmaop-eddollarrussiapoloniexgovernancedecentralized exchangehiringmoneroafricaeventsurveynetherlandsstakingfunding roundscoinmarketcapamldonationscharityhard forkecbtaxcentral bank digital currenciesjobschangpeng zhaopoliceukpolkadotcardanoethereum priceledgermarketfacebook libravitalik buterinsingaporecybercrimeeditorspickstron newsbloombergprojectscircleblockfimapsunited kingdomgeminialtcoin newsbytecoincryptocurrency chartscryptocurrency listlitecoin walletnew cryptocurrencypeercoinvertcoinmoneygramlitelink technologies-prcse:lltcmetonaltcoin pricesdash coinethereum 2.0press releasepreth 2.0buy litecointransactionsnest cryptocurrecnyguest postyoutuberipple pricelitelink technologies inc.samsungpredictionstwittertaxesransomwareenergygameslawsuitcraig wrightbitgop2pwirecardico and ieocalibrasmart contractsconsensysoptionsdigibytecftcmastercardr3macro analysisdltdataipocrypto coinsfrancesouth koreabitcoin scamscompwebinarbitcoin regulationmaker$usdtstocksieoindiasatoshi nakamotolightning networkaustraliadydxpaidposteth priceethereum bitcoinethereum coin priceethereum valuefinancial newsmining ethereumwhere to buy ethereumpaidgoldsocial mediaftxcryptocurrency ethereumethereum coinethereum news todayethereum vs bitcoinhuobiethereum miningvisafintechrobinhoodethereum price chartwalletchainlinkfraudfuturesstellaroil$xrptronhong konghacksprice analysisuniswapcentral bankscongresscentral bankblockchain companiesblockchain explorerblockchain for dummiesblockchain ledgerblockchain tutorialblockchain updatesdaily blockchain newsinfrastructuresponsoredblockchain explainedblockchain infoblockchain wikibakktblockchain appblockchain stockblockchain newsfundingcovid-19open financebitfinexinvestmentkrakenokexxrpbinance coinscamscryptothe scoopbitcoin svbitcoin futuresusdcmakerdaopodcaststelegramcrimesaltcoinsblogbitcoin miningtradingseoscompoundfinancial institutionsripple bankingripple coin newsripple currencyripple walletripple xcurrentwhat is xrapid ripplexcurrentxcurrent xrapid xrpxrapidlitecoinpodcastbitcoin cashbuy xcurrentripple stockripple blockchainripple coin miningripple exchangeripple xrp pricexrapid xrpripple blockchain technologyxcurrent vs xrapidripple vs bitcoinbitmainjapanripple labsdecentralizationmarket updateeuropemarket analysisswitzerlandsupply chaincrimepartnershipgenesisfinancecoin newscrypto updatescryptocurrency 2017cryptocurrency news updatescryptocurrency updateslatest cryptocurrencylatest cryptocurrency newsnew cryptocurrency releaseethereum newsinstitutionalcoin news todaydigital currency newscryptocurrency pricescrypto news updatescryptocoinsnewscryptonewsnew crypto coinsnew cryptocurrency 2017best cryptocurrency exchangecrypto exchangecryptocurrency exchange platformcryptocurrency exchanges by volumecryptocurrency trading siteskraken exchangelist of cryptocurrency exchangestop 5 cryptocurrency exchangesdexcryptocurrency exchange ratesbitcoin altcoin exchangecryptocurrency exchange sitescryptocurrency trading platformexchange cryptocurrencycryptocurrency exchange listcryptocurrency exchangestezosderivativestethertradingdairipple coinbankscbdcusabitmexresearchprivacymilestonelendinglawcapital marketsicocustodydigital currencycryptocurrency newsairdropbitcoin exchangebitcoin news feedbitcoin news latestbitcoin news updatesbitcoin stockbreaking newsrecent newssecuritybitcoin price newsbitcoin latest newsbitcoin news todaybitcoin pricescurrent news[object object]bitcoin halvingtokensripple newshalvingpaymentsgovernmentnewslegalexchange_listingcrypto newsasiasecsoftware_releaselibracryptocurrency tradingstablecoinunited statesstablecoins$ethcryptocurrency marketthe blockfacebookrippleadoptionbitcoin newscoronaviruscompaniesinvestmentschinacoinbasebinancecryptocurrency exchangealtcoinbusinessexchangedefi$btcbitcoin pricetechnologyminingregulationeditorialprconnectexchangesmarketscryptocurrencyethereumcryptocurrenciesblockchainbitcoingeneralspanishfrenchreddit

Follow us

Latest blogs
Le port le plus achalandé d'Europe lance un projet pilote de manutention de cont
Fri Jul 10 2020 08:18:37 GMT+0000 (Coordinated Universal Time)
BitClub Programmer Pleads Guilty for $722 Million Crypto Fraud (Finance Magnates
Fri Jul 10 2020 08:14:36 GMT+0000 (Coordinated Universal Time)
Max Keiser - No Coin Can Do Something That Btc Doesn’t Do Already (Reddit Bitcoi
Fri Jul 10 2020 08:14:34 GMT+0000 (Coordinated Universal Time)
Ethereum and EOSIO Square Up Over Enterprise Blockchain Business in Latin Americ
Fri Jul 10 2020 08:13:58 GMT+0000 (Coordinated Universal Time)
Bitfinex Lists Dogecoin After TikTok Fad Sends DOGE Price Over $0.05 (Cointelegr
Fri Jul 10 2020 08:10:00 GMT+0000 (Coordinated Universal Time)